The short version of lyophilised powder fits in a sentence. The long version — which is the one that helps — is below.
Reviewed 2025-12-27. Anything still debated is marked as such rather than presented as settled.
Identity and purity are checked by reversed-phase high-performance liquid chromatography, usually with ultraviolet detection near 214 nanometres, where the peptide bond absorbs. Mass spectrometry confirms the expected mass and reveals whether truncation products or adducts are present. Acid hydrolysis followed by amino acid analysis gives the residue ratio, which should approximate one alanine, one glutamate, one aspartate and one glycine. Counter-ions such as acetate or trifluoroacetate remain in the dried product and lower net peptide content, so a stated purity figure on a label does not by itself describe how much peptide a vial holds.
Regulatory treatment differs by country. No formulation of epitalon holds a marketing authorisation as a medicine in the United States or the European Union, where material sold for laboratory use is handled as a research chemical and is not intended for human consumption. In Russia, several short peptide preparations from the same institute's peptide series are registered medicinal products, and epitalon appears in that national context. Elsewhere it is frequently offered as a cosmetic ingredient, a category with lighter requirements. Advertising claims about longevity or disease prevention are restricted in most jurisdictions, which limits how sellers describe the compound.
Freeze-dried epitalon is normally kept at minus twenty degrees Celsius in a sealed, desiccated container, protected from light. Short excursions at ambient temperature during shipping are generally tolerated, but repeated warming and cooling cycles encourage moisture uptake, which shortens shelf life. Once dissolved, the peptide is far less stable than the solid: aqueous solutions are subject to hydrolysis and to deamidation at the aspartate and glutamate residues. Working solutions are therefore held refrigerated and used within days, and repeated freezing and thawing of the same vial is best avoided.
Chemically, the molecule consists of four amino acid residues joined by three peptide bonds, with a free N-terminal amino group and a free C-terminal carboxyl group. Its molecular formula is C14H22N4O9, and its monoisotopic mass is approximately 390 daltons. The acidic glutamate and aspartate side chains give the peptide a net negative charge near neutral pH, a property that shapes its chromatographic behaviour and solubility profile. No disulfide bridges or other post-translational modifications are present, so the primary sequence alone defines the structure.
Most experimental work has been carried out in cell culture and animal models. Several reports describe changes in telomerase activity and proliferation in cultured cells, while rodent studies have examined lifespan, melatonin rhythm and reproductive endpoints. Human data remain limited, and much of the published clinical material consists of small trials with incomplete reporting of methods and controls. Whether the cell and animal findings translate into measurable effects in people is an open question, and the mechanistic basis of the reported telomerase changes is not fully established.
Discussions in the literature often conflate three distinct entities: the pineal extract epithalamin, the isolated tetrapeptide AEDG, and commercial preparations sold under similar names. Reviews citing older Russian-language studies sometimes omit detail on purity, route of administration and control groups, which makes cross-study comparison difficult. Researchers working with the compound generally note the need for independent replication, standardized enzyme assays, and clearer reporting of peptide identity. These caveats are relevant when weighing claims that appear in secondary sources rather than in primary reports.
| Property | Value | Notes |
|---|---|---|
| Storage temperature, solid | Approximately -20 C | Sealed, desiccated, protected from light |
| Typical identity method | Electrospray mass spectrometry | Protonated ion expected near 391 |
| Typical purity method | Reversed-phase HPLC | Ultraviolet detection near 214 nm |
| Common synonyms | Epithalon, epithalone, AEDG | Spelling variants appear in supplier catalogues |
| Solution stability | Days at 2-8 C | Hydrolysis and deamidation limit shelf life |
Verification of research-grade material involves comparing a supplier chromatogram against an in-house reference, checking the observed mass against the calculated value, and where possible confirming residue order by tandem mass spectrometry or enzymatic peptide mapping. Purity claims should be read alongside the method used to obtain them, because detection wavelength and integration settings alter the result. Batch-specific data, rather than a generic grade statement, is the informative part of a certificate.
Identity and purity of epitalon samples are normally established by reversed-phase high-performance liquid chromatography with ultraviolet detection near 214 nanometres, combined with mass spectrometry. The mass spectrum confirms the expected molecular ion and can reveal truncated or oxidised by-products. Amino acid analysis after acid hydrolysis verifies that the four residues are present in the expected ratio. Certificates typically report a purity figure taken from chromatographic peak area, expressed as a percentage of total integrated signal.
Several names circulate for the same molecule, including epitalon, epithalone, epithalamin tetrapeptide, and the sequence code AEDG. A CAS registry number, 307297-39-8, is commonly cited for it, though catalogue entries should be checked against supplier documentation because mislabelled records occur. In its usual form the peptide carries free amino and carboxyl termini and is neither glycosylated nor lipidated. Researchers distinguish the defined tetrapeptide from epithalamin itself, a crude pineal preparation containing many peptides that is not chemically characterised.
Material supplied for laboratory use is normally a lyophilised white to off-white powder that dissolves readily in water and in isotonic saline. Lyophilised cakes are hygroscopic and should be equilibrated to room temperature before opening to limit condensation on the solid. Solutions are typically prepared at milligram-per-millilitre concentrations and divided into single-use aliquots, because repeated freeze–thaw cycles degrade short peptides. Aqueous solutions are far less stable than the dry powder, and identity is usually verified by mass spectrometry alongside purity estimation from reversed-phase high-performance liquid chromatography.
Epitalon is a synthetic linear tetrapeptide with the sequence alanine–glutamate–aspartate–glycine, abbreviated AEDG. Its molecular formula is C14H22N4O9 and the calculated mass is approximately 390.35 g/mol. The compound is made by solid-phase peptide synthesis rather than extracted from tissue, although early work described it as a short fragment of a peptide fraction obtained from bovine pineal extract. In the research literature the spelling epitalon and the variant epithalone both appear, while AEDG is the standard code used in peptide nomenclature.
No pharmacopoeial monograph exists for this peptide, so quality rests on the supplier's internal specifications and on whatever independent testing a purchaser arranges. Certificates of analysis differ widely in which tests they report and in the limits applied. The counter-ion introduced during purification, commonly acetate or trifluoroacetate, changes the net peptide content of a given mass of powder, so two samples of equal weight may not contain equal amounts of the active sequence. Third-party laboratories can verify purity, identity, residual solvents, and counter-ion content for a fee, which makes documentation more informative than labelling.
Verification of a sample usually begins with reversed-phase high-performance liquid chromatography, which resolves the peptide from truncated sequences and other impurities and expresses purity as a percentage of total peak area. Mass spectrometry by electrospray ionisation or matrix-assisted laser desorption supplies an independent check, because the measured mass can be compared against the theoretical value for AEDG. Amino acid analysis or tandem mass spectrometry sequencing can confirm residue order. Each of these methods answers a different question: a purity figure does not establish identity, and an identity match does not establish how much of the material is intact peptide.
== In culture == Although observations of soy consumption inducing gynecomastia on men are not conclusive, a pejorative term, "soy boy", has emerged to describe perceived emasculated young men with feminine traits.
On the same day as the 2019–20 state budget, Pritzker signed the "Fair Tax" law, which offered a constitutional amendment to voters in the November 2020 election to replace Illinois's flat tax with graduated rates. He promised that income taxes would not increase for Illinoisans who make $250,000 a year or less, who are 97% of the state's wage earners. Pritzker and his supporters said changing income tax laws was the first step toward comprehensive state tax reform. According to the governor's office, under this proposal, families and couples would see tax cuts across the board. For example, a family of four making $61,000 a year would pay $41 less in income tax before any other tax exemptions or deductions. Moreover, there would be a tax credit of up to $100 per child for individuals making less than $80,000 and joint filers earning under $100,000. The corporate tax rate would rise from 7% to 7.95%, equal to the highest personal rate. In addition, Pritzker wanted to increase the property tax credit to 6% from 5%. Pritzker donated more than $55 million to "Vote Yes for Fairness", a committee that supported the tax change. The tax change set up a fight between Pritzker and Ken Griffin, who donated over $50 million to a group opposing it. Griffin called Pritzker "spineless", accusing him of trying "to sell a trick disguised as a solution", and pointed to Pritzker's offshore trusts and personal tax avoidance schemes as hypocritical. Pritzker claimed that his income tax proposal would bring $3.4 billion in tax revenue.
Mariusz Zbigniew Pudzianowski (Polish pronunciation: [ˈmarjuʂ pudʑaˈnɔfskʲi]; born 7 February 1977), also known as 'Pudzian' and 'Dominator', is a Polish former strongman and mixed martial artist. With 43 international titles at a record 70% win percentage, 58 total wins, 71 podiums and 28 world records in his strongman career. During his career as a strongman, Pudzianowski won five World's Strongest Man titles in 2002, 2003, 2005, 2007 and 2008, the most in the 48 year history of the competition. He also won two runner-up titles in 2006 and 2009 and made 9 out of 9 appearances into the World's Strongest Man final (a feat replicated only by Hafþór Júlíus Björnsson since then). While securing eight World Strongman Cup Federation wins and twelve Strongman Super Series wins, he also won the Europe's Strongest Man title a record six times and the Poland's Strongest Man title a record seven times. In 2009, Pudzianowski started his career as a mixed martial artist. By 2022, he had won his 17th professional fight.
== Malignant neoplasm of digestive organs and peritoneum (150–159) == 150 Malignant neoplasm of esophagus 151 Malignant neoplasm of stomach 152 Malignant neoplasm of small intestine, including duodenum 153 Malignant neoplasm colon 154 Malignant neoplasm of rectum, rectosigmoid junction, and anus 155 Malignant neoplasm of liver and intrahepatic bile ducts 156 Malignant neoplasm of gallbladder and extrahepatic bile ducts 157 Malignant neoplasm of pancreas 158 Malignant neoplasm of retroperitoneum and peritoneum 159 Malignant neoplasm of other and ill-defined sites within the
== Sources == Schaffer, Phillip Otto Folin: (1867–1934) (Journal of Nutrition. volume 52, issue 1, pages 3–11. 1954) [1] Edsall, John T. A Biomedical Pioneer (Science, volume 244 (4905), pages 719–720. 1989, doi 10.1126/science.244.4905.719)
Sources: en.wikipedia.org
=== Absorption === Strychnine may be introduced into the body orally, by inhalation, or by injection. It is a potently bitter substance, and in humans has been shown to activate bitter taste receptors TAS2R10 and TAS2R46. Strychnine is rapidly absorbed from the gastrointestinal tract.
=== Dinosaurs === It has been theorized that the neural spines of Spinosaurus, Ouranosaurus, and other dinosaurs with similar spines had humps, rather than the sailfins they are commonly depicted as having. If true, such humps would aid with heat regulation, storing of lipids for egg production, and storing fat for long migrations. Concavenator corcovatus is named for its hump (the name means "hunchback hunter from Cuenca"), but its use is debated, with theories including heat regulartion, attracting mates, intimidating rivals, or fat storage.
The Gallery of Botany is on the Allée the Buffon facing the centre of the garden, between the Gallery of Mineralogy and the Gallery of Palaeontology. At the corner is one of the two oldest trees in Paris, a Robinia pseudoacacia or black locust, planted in 1635 by Vespasien Robin, the royal gardener and botanist, from an earlier tree brought from America by his brother, also a botanist, in 1601. It is tied in age with another from the same source planted at the same time on the square of Saint-Julien-le-Pauvre. The Gallery was built in 1930–35 with a grant from the Rockefeller Foundation. Directly in front is a statue entitled "Science and Mystery" by Jean-Louis Schroeder, made in 1889. It depicts an old man pondering an egg, contemplating the enigma of which came first. The primary content of the gallery is the Herbier National, a collection representing 7.5 million plants collected since the founding of the museum. They are divided for study into Spermatophytes, plants which reproduce with seeds, and cryptogams, plants which reproduce with spores, such as algae, lichens and mushrooms. Many of the plants were collected by Jean Baptiste Christophore Fusée Aublet, the royal pharmacist and botanist in French Guiana. In 1775 he published his "Histoire des plantes de la Guiane Française" describing 576 genera and 1,241 species of neotropical plants, including more than 400 species that were new to science, at a time when only 20,000 plants had been described, The ground floor interior of the gallery has vestibules built in a combination of Art Deco and Neo-Egyptian styles.
It is important for MADD patients to maintain strength and fitness without exercising or working to exhaustion. Learning this balance may be more difficult than normally, as muscle pain and fatigue may be perceived differently from normal individuals. Symptomatic relief from the effects of MADD may sometimes be achieved by administering ribose orally at a dose of approximately 10 grams per 100 pounds (0.2 g/kg) of body weight per day, and exercise modulation as appropriate. Taken hourly, ribose provides a direct but limited source of energy for the cells. Patients with myoadenylate deaminase deficiency do not retain ribose during heavy exercise, so supplementation may be required to rebuild levels of ATP. Creatine monohydrate could also be helpful for AMPD patients, as it provides an alternative source of energy for anaerobic muscle tissue and was found to be helpful in the treatment of other, unrelated muscular myopathies. Inborn Errors of Metabolism Metabolic Myopathies Purine Nucleotide Cycle
The Streptavidin-Binding Peptide (SBP)-Tag is a 38-amino acid sequence that may be engineered into recombinant proteins. Recombinant proteins containing the SBP-Tag bind to streptavidin and this property may be utilized in specific purification, detection or immobilization strategies. The sequence of the SBP tag is MDEKTTGWRGGHVVEGLAGELEQLRARLEHHPQGQREP. The Streptavidin-Binding Peptide was discovered within a library of seven trillion stochastically generated peptides using the in vitro selection technique of mRNA Display. Selection was performed by incubating with streptavidin-agarose followed by elution with biotin. The SBP-Tag has been shown to bind streptavidin with an equilibrium dissociation constant of 2.5nM and is readily eluted with biotin under native conditions.
Sources: en.wikipedia.org
The clinical significance of bilirubin glucuronide is involved in many conditions. Drugs that inhibit the activities of the components involved in bilirubin metabolism can give rise to accumulation of bilirubin in the blood. In comparison, conjugation of some drugs is also usually impaired if the liver cannot normally metabolize indirect bilirubin. When excretion of bilirubin glucuronide by the kidney is detected in the urine through urine examination, meaning that a conspicuous amount of conjugated bilirubin is present and circulating in the blood. In Dubin–Johnson syndrome, impaired biliary excretion of bilirubin glucuronide is due to a mutation in the canalicular multiple drug-resistance protein 2 (MRP2). A darkly pigmented liver is due to polymerized epinephrine metabolites, not bilirubin.
== Synthesis == [18F]FDG was first synthesized via electrophilic fluorination with [18F]F2. Subsequently, a "nucleophilic synthesis" was devised with the same radioisotope. As with all radioactive 18F-labeled radioligands, the fluorine-18 must be made initially as the fluoride anion in a cyclotron. Synthesis of complete [18F]FDG radioactive tracer begins with synthesis of the unattached fluoride radiotracer, since cyclotron bombardment destroys organic molecules of the type usually used for ligands, and in particular, would destroy glucose. Cyclotron production of fluorine-18 may be accomplished by bombardment of neon-20 with deuterons, but usually is done by proton bombardment of 18O-enriched water, causing a (p-n) reaction (sometimes called a "knockout reaction" – a common type of nuclear reaction with high probability where an incoming proton "knocks out" a neutron) in the 18O. This produces "carrier-free" dissolved [18F]fluoride ([18F]F−) ions in the water. The 109.8-minute half-life of fluorine-18 makes rapid and automated chemistry necessary after this point. Anhydrous fluoride salts, which are easier to handle than fluorine gas, can be produced in a cyclotron. To achieve this chemistry, the [18F]F− is separated from the aqueous solvent by trapping it on an ion-exchange column, and eluted with an acetonitrile solution of 2,2,2-cryptand and potassium carbonate. Evaporation of the eluate gives [(crypt-222)K]+ [18F]F− (2) .
However, the advent of biologic therapeutics has also raised complex regulatory issues (see below), and significant pharmacoeconomic concerns because the cost for biologic therapies has been dramatically higher than for conventional (pharmacological) medications. This factor has been particularly relevant since many biological medications are used to treat chronic diseases, such as rheumatoid arthritis or inflammatory bowel disease, or for the treatment of otherwise untreatable cancer during the remainder of life. The cost of treatment with a typical monoclonal antibody therapy for relatively common indications is generally in the range of €7,000–14,000 per patient per year. Older patients who receive biologic therapy for diseases such as rheumatoid arthritis, psoriatic arthritis, or ankylosing spondylitis are at increased risk for life-threatening infection, adverse cardiovascular events, and malignancy. The first such substance approved for therapeutic use was biosynthetic "human" insulin made via recombinant DNA. Sometimes referred to as rHI, under the trade name Humulin, was developed by Genentech, but licensed to Eli Lilly and Company, who manufactured and marketed it starting in 1982. Major kinds of biopharmaceuticals include:
In January 2023, Futurism broke the story that CNET had been using an undisclosed internal AI tool to write at least 77 of its stories; after the news broke, CNET posted corrections to 41 of the stories. In April 2023, Die Aktuelle published an AI-generated fake interview of Michael Schumacher. In May 2024, Futurism noted that a content management system video by AdVon Commerce, which had used generative AI to produce articles for many of the aforementioned outlets, appeared to show that they "had produced tens of thousands of articles for more than 150 publishers". In 2025, a report from the American Sunlight Project stated that Pravda network was publishing as many as 10,000 articles a day, and concluded that much of this content aimed to push Russian narratives into large language models through their training data. In June 2024, Reuters Institute published its Digital News Report for 2024. In a survey of people in America and Europe, Reuters Institute reports that 52% and 47% respectively are uncomfortable with news produced by "mostly AI with some human oversight", and 23% and 15% respectively report being comfortable. 42% of Americans and 33% of Europeans reported that they were comfortable with news produced by "mainly human with some help from AI". The results of global surveys reported that people were more uncomfortable with news topics including politics (46%), crime (43%), and local news (37%) produced by AI than other news topics. A 2025 Pew Research Survey found roughly half of all U.S.
Sources: en.wikipedia.org
The solid is kept cold, dry and dark, typically at minus twenty degrees Celsius, in a sealed container with desiccant. Dissolved material is kept refrigerated and used promptly. Freezing and thawing a solution repeatedly is avoided because it accelerates degradation.
Reversed-phase chromatography with ultraviolet detection gives a purity percentage, while mass spectrometry confirms identity. Amino acid analysis checks the residue composition. Buyers typically request a certificate of analysis showing these measurements for the specific lot.
It is not authorised as a medicine in the United States or the European Union. Material is sold there as a research chemical or cosmetic ingredient. Some related short peptides are registered drugs in Russia, which is a distinct national situation rather than a general approval.
It is a synthetic tetrapeptide with the sequence alanine-glutamate-aspartate-glycine, often abbreviated AEDG. The molecule is linear and contains no modified residues, so it is fully described by its sequence.