This is a working overview of lyophilisation, written for readers who want more than a one-paragraph summary but less than a textbook.
This page was last updated on 2026-03-18 and is reviewed periodically as new material appears.
Material sold for research use varies widely in documented quality. A useful verification package includes a certificate of analysis that states peptide content rather than only net weight, the chromatographic method and column used, and a mass spectrum consistent with the expected mass. Independent testing by a third-party laboratory is occasionally reported. Statements of identity resting only on a supplier label provide little assurance, and the gap between nominal mass and actual peptide content can be substantial once counterions and residual water are counted.
Peptides of this size are generally stable as dry solids but degrade in solution over time. The principal routes are hydrolysis of the peptide backbone and oxidation, with hydrolysis favoured by elevated temperature and extreme pH. Aqueous solutions held at room temperature can show measurable loss of purity within days, while frozen aliquots are considerably more durable. Because the sequence contains neither cysteine nor methionine, oxidation is less of a concern than for many other peptides, but pH control during handling still matters.
Typical storage for the lyophilized powder is −20 °C or lower, in a sealed container protected from light and moisture. Hygroscopic material should be allowed to equilibrate to room temperature before the vial is opened, which limits condensation on the contents. Working solutions are commonly divided into single-use aliquots and frozen to avoid repeated freeze-thaw cycles. Dilute solutions are more prone to adsorption onto plastic surfaces and to loss during filtration, so procedures that minimize transfers and use low-binding labware are preferable.
Solubility is high in water, phosphate-buffered saline and normal saline, a pattern that follows from the two acidic residues in the chain. The peptide dissolves poorly in non-polar solvents such as hexane or chloroform. Stock solutions are often prepared in water first and then diluted into the buffer of interest. Because the molecule is small and hydrophilic, filtration through a low-protein-binding membrane is usually straightforward, and visible particulates are uncommon in freshly made solutions.
Identity and purity are established with reversed-phase high-performance liquid chromatography and mass spectrometry. The chromatogram shows the main peak and any truncated or oxidised by-products, while the mass spectrum confirms the expected 390 dalton mass. Amino acid analysis can corroborate composition when a sample's origin is uncertain. Counterion content, particularly residual trifluoroacetate from purification, is frequently reported alongside purity because it shifts the net mass of the solid.
Reference material is normally supplied as a lyophilised powder in a sealed vial. Product literature typically recommends storage at minus twenty degrees Celsius or colder, protected from light and moisture. Freeze-thaw cycling is usually avoided because repeated condensation can introduce water into the vial. Working solutions are commonly prepared fresh, aliquoted, and kept cold for short periods rather than stored at ambient temperature. Labelling the date of opening helps track how long a vial has been in use.
| Property | Value | Notes |
|---|---|---|
| Appearance | White to off-white powder | Lyophilized solid |
| Solubility | Freely soluble in water | Also dissolves in polar organic solvents |
| Typical storage temperature | −20 °C or below | Sealed, desiccated, protected from light |
| Primary purity assay | Reversed-phase HPLC | Ultraviolet detection near 214 nm |
| Identity confirmation | Mass spectrometry | Electrospray ionization commonly used |
Short peptides such as AEDG are normally supplied as a freeze-dried solid and are kept dry, cold, and shielded from light. Holding at minus twenty degrees Celsius is common for the long term, while a refrigerator suffices for brief periods before use. The material takes up moisture to some degree, so containers should stay sealed and be allowed to reach room temperature before opening, which limits condensation on the contents. Repeated warming and cooling of a single container is discouraged because it admits water and can lower the amount of intact peptide.
Dissolution is usually performed in water or a suitable aqueous buffer, and the resulting liquid is divided into single-use portions before freezing. Freeze-thaw cycling is a recognised source of loss for short peptides, since each cycle can encourage aggregation or adsorption onto container walls. Working solutions are generally kept cold and used within a short window, although published stability data specific to epitalon are thin. Containers should be marked with concentration and date, and solutions examined for cloudiness before use.
Identity is normally established by reversed-phase high-performance liquid chromatography combined with mass spectrometry, a pairing that separates components and confirms molecular mass at once. Purity is quoted as a percentage from the chromatogram, and figures above ninety-five percent are a frequent commercial specification. Amino acid analysis or sequencing supplies further confirmation when required. Because many short peptides behave similarly under chromatography, retention time alone does not establish sequence; the mass measurement is what separates one tetrapeptide from another, and certificates should report both.
Identity and purity of epitalon samples are normally established by reversed-phase high-performance liquid chromatography with ultraviolet detection near 214 nanometres, combined with mass spectrometry. The mass spectrum confirms the expected molecular ion and can reveal truncated or oxidised by-products. Amino acid analysis after acid hydrolysis verifies that the four residues are present in the expected ratio. Certificates typically report a purity figure taken from chromatographic peak area, expressed as a percentage of total integrated signal.
Lyophilised epitalon is generally held at minus twenty degrees Celsius in a sealed container kept dry and dark. Cooler conditions are sometimes recommended for long-term archives. The solid takes up moisture readily enough that repeated opening of a vial introduces water, so dividing a batch into smaller portions before storage lowers degradation risk. Aqueous solutions are less durable than the dry powder and are usually prepared shortly before use, then kept cold and shielded from light to slow hydrolysis and oxidation.
Verification of research-grade material involves comparing a supplier chromatogram against an in-house reference, checking the observed mass against the calculated value, and where possible confirming residue order by tandem mass spectrometry or enzymatic peptide mapping. Purity claims should be read alongside the method used to obtain them, because detection wavelength and integration settings alter the result. Batch-specific data, rather than a generic grade statement, is the informative part of a certificate.
=== Psychological profile === Prior to the trial, the court ordered further psychological assessment for Agüero. The evaluating professionals determined that Agüero has a "self-centered personality", and that she seeks "recognition, power, and admiration", plus "lack of empathy and affection, with expressions of satisfaction from close contact with another person's suffering". The mental health professionals also found that Agüero has traits of a dissociative personality disorder, with one side of her personality being completely aware of reality, while the other side denies said reality and compensates for it with the production of her wishes. The same professionals stated that these traits are "typical mechanisms of a psychopathic personality". During the trial, further testimony was presented by mental health professionals. Psychologist Martínez Goyena said that Agüero does not suffer from any active mental health disorder, and that she is capable of understanding reality. Further analysis showed narcissistic, self-referential, and psychopathic traits. Defense psychiatrist Quiroga said, in contrast, that there are no previous indicators that Agüero could have psychopathic features in her personality. Multiple mental health professionals testified on 18 February that Agüero seeks "visibility" for her crimes, as well as repeating pre-trial examination findings that she lacks empathy, citing the total reluctance by Agüero to acknowledge the suffering of the families of the murdered babies.
The unusual stability of the helium-4 nucleus is also important cosmologically: it explains the fact that in the first few minutes after the Big Bang, as the "soup" of free protons and neutrons which had initially been created in about 6:1 ratio cooled to the point that nuclear binding was possible, almost all first compound atomic nuclei to form were helium-4 nuclei. Owing to the relatively tight binding of helium-4 nuclei, its production consumed nearly all of the free neutrons in a few minutes, before they could beta-decay, and thus few neutrons were available to form heavier atoms such as lithium, beryllium, or boron. Helium-4 nuclear binding per nucleon is stronger than in any of these elements (see nucleogenesis and binding energy) and thus, once helium had been formed, no energetic drive was available to make elements 3, 4 and 5. It is barely energetically favorable for helium to fuse into the next element with a lower energy per nucleon, carbon. However, due to the short lifetime of the intermediate beryllium-8, this process requires three helium nuclei striking each other nearly simultaneously (see triple-alpha process). There was thus no time for significant carbon to be formed in the few minutes after the Big Bang, before the early expanding universe cooled to the temperature and pressure point where helium fusion to carbon was no longer possible. This left the early universe with a very similar ratio of hydrogen/helium as is observed today (3 parts hydrogen to 1 part helium-4 by mass), with nearly all the neutrons in the universe trapped in helium-4.
Chorea-acanthocytosis (ChAc, also called choreoacanthocytosis) is a rare hereditary disease—evidence suggests that only 500 to 1,000 people worldwide have the condition. It is caused by a mutation in a gene that directs structural proteins in red blood cells. It belongs to a group of four diseases characterized under the name neuroacanthocytosis. When a patient's blood is viewed under a microscope, some of the red blood cells appear thorny. These thorny cells are called acanthocytes. Other effects of the disease may include involuntary muscle movements, impaired balance and coordination, behavioral changes, memory problems, difficulty swallowing, speech difficulties, seizures, muscle weakness, personality changes, and neuronal degradation similar to Huntington's disease. The average age of onset of symptoms is 35 years. The disease is incurable and inevitably leads to premature death. Chorea-acanthocytosis is a very complex autosomal recessive adult-onset neurodegenerative disorder. It often shows itself as a mixed movement disorder, in which chorea, tics, dystonia and even parkinsonism may appear as a symptom. This disease is also characterized by the presence of a few different movement disorders including chorea, dystonia etc. Chorea-acanthocytosis is considered an autosomal recessive disorder, although a few cases with autosomal dominant inheritance have been noted.
Cecropin A Peptide Sequence (KWKLFKKIEKVGQNIRDGIIKAGPAVAVVGQATQIAK). Secondary structure includes two α helices. At low peptide to lipid ratios ion channels are formed, at high peptide to lipid ratios pores are formed. Cecropin B Peptide Sequence (KWKVFKKIEKMGRNIRNGIVKAGPAIAVLGEAKAL). Secondary structure includes two α helices. CECD from Aedes aegypti (Yellowfever mosquito). Papiliocin from Papilio xuthus (a butterfly) Cecropin P1 Peptide Sequence (SWLSKTAKKLENSAKKRISEGIAIAIQGGPR). An antibacterial peptide from Ascaris suum, a parasitic nematode that resides in the pig intestine, also belongs to this family.
Sources: en.wikipedia.org
=== Byzantine mosaics === Raymond created 55 plates grouped together under the title Essai de reconstitution de mosaïques byzantines (Attempt to reproduce Byzantine mosaics). He portrayed the most famous mosaics of Greek, Italian and Turkish churches. He used photographs that he divided into segments and then scale reproduced down to the finest detail; a technique that would much later be known as “micro-mosaics”.
== Recognition == In 1999, the University of Oulu collagen research group received, for the second time, the Finnish Science Award, divided amongst the group's members. In addition to Ala-Kokko, the group included professors Kari Kivirikko and Taina Pihlajaniemi. In 2001 she received the Norwegian Anders Jahre Prize for Young Scientists.
== History == The earliest written descriptions of thiamine deficiency are from ancient China in the context of Chinese medicine. One of the earliest is by Ge Hong in his book Zhou hou bei ji fang (Emergency Formulas to Keep up Your Sleeve) written sometime during the third century. Hong called the illness by the name jiao qi, which can be interpreted as "foot qi". He described the symptoms to include swelling, weakness, and numbness of the feet. He also acknowledged that the illness could be deadly, and claimed that it could be cured by eating certain foods, such as fermented soybeans in wine. Better known examples of early descriptions of "foot qi" are by Chao Yuanfang (who lived during 550–630) in his book Zhu bing yuan hou lun (Sources and Symptoms of All Diseases) and by Sun Simiao (581–682) in his book Bei ji qian jin yao fang (Essential Emergency Formulas Worth a Thousand in Gold). In the mid-19th century, interest in beriberi steadily rose as the disease became more noticeable with changes in diet in East and Southeast Asia. A steady uptick occurred in medical publications, reaching 181 publications from 1880 and 1889, and hundreds more in the following decades. The link to white rice was clear to Western doctors, but a confounding factor was that some other foods such as meat failed to prevent beriberi, so it could not be easily explained as a lack of known chemicals like carbon or nitrogen. With no knowledge of vitamins, the etiology of beriberi was among the most hotly debated subjects in Victorian medicine.
Sources: en.wikipedia.org
Sickle cell disease is a group of diseases caused by a mutation in a subunit of hemoglobin, a protein found in red blood cells responsible for transporting oxygen. The most dangerous of the sickle cell diseases is known as sickle cell anemia. Sickle cell anemia is the most common homozygous recessive single gene disorder, meaning the affected individual must carry a mutation in both copies of the affected gene (one inherited from each parent) to experience the disease. Hemoglobin has a complex quaternary structure and is composed of four polypeptide subunits – two A subunits and two B subunits. Patients with sickle cell anemia have a missense or substitution mutation in the gene encoding the hemoglobin B subunit polypeptide chain. A missense mutation means the nucleotide mutation alters the overall codon triplet such that a different amino acid is paired with the new codon. In the case of sickle cell anemia, the most common missense mutation is a single nucleotide mutation from thymine to adenine in the hemoglobin B subunit gene. This changes codon 6 from encoding the amino acid glutamic acid to encoding valine. This change in the primary structure of the hemoglobin B subunit polypeptide chain alters the functionality of the hemoglobin multi-subunit complex in low oxygen conditions. When red blood cells unload oxygen into the tissues of the body, the mutated haemoglobin protein starts to stick together to form a semi-solid structure within the red blood cell.
== History == Emoxypine was first synthesized by L.D. Smirnov and K.M. Dumayev, then studied and developed in the Russian Institute of Pharmacology, Russian Academy of Medical Sciences and Russian Scientific Center of Bioactive Substances Safety. Its research and use has been largely isolated to former Soviet states, with little interest from other countries.
== External links == Clinical trial number NCT01681953 for "A Placebo-Controlled Phase 3 Trial of Repeated Lamazym Treatment of Subjects With Alpha-Mannosidosis" at ClinicalTrials.gov Clinical trial number NCT02998879 for "Trial on Safety and Efficacy of Velmanase Alfa Treatment in Pediatric Patients With Alpha-Mannosidosis (rhLaman-08)" at ClinicalTrials.gov alpha-Mannosidase at the U.S. National Library of Medicine Medical Subject Headings (MeSH)
Sources: en.wikipedia.org
The powder is normally kept at −20 °C or below in a sealed, moisture-protected container. Letting the vial reach room temperature before opening helps prevent condensation on the contents.
Reversed-phase HPLC with ultraviolet detection is the usual approach, often paired with mass spectrometry. Together the two methods address both chromatographic purity and molecular identity.
Differences arise from the analytical method, the detection wavelength, and whether the number refers to the peptide or to total powder mass. Counterion and water content can lower the actual peptide fraction considerably.
Sealed lyophilised powder is normally kept at minus twenty degrees Celsius or below, away from light and moisture. Vials are allowed to reach room temperature before opening to limit condensation. Repeated warming and cooling of the same vial is discouraged.