A practical reference on Telomerase: what it is, how it behaves, what the literature reports, and where the honest uncertainties sit.
Reviewed 2026-08-01. Anything still debated is marked as such rather than presented as settled.
Material sold for research use varies widely in documented quality. A useful verification package includes a certificate of analysis that states peptide content rather than only net weight, the chromatographic method and column used, and a mass spectrum consistent with the expected mass. Independent testing by a third-party laboratory is occasionally reported. Statements of identity resting only on a supplier label provide little assurance, and the gap between nominal mass and actual peptide content can be substantial once counterions and residual water are counted.
Peptides of this size are generally stable as dry solids but degrade in solution over time. The principal routes are hydrolysis of the peptide backbone and oxidation, with hydrolysis favoured by elevated temperature and extreme pH. Aqueous solutions held at room temperature can show measurable loss of purity within days, while frozen aliquots are considerably more durable. Because the sequence contains neither cysteine nor methionine, oxidation is less of a concern than for many other peptides, but pH control during handling still matters.
Typical storage for the lyophilized powder is −20 °C or lower, in a sealed container protected from light and moisture. Hygroscopic material should be allowed to equilibrate to room temperature before the vial is opened, which limits condensation on the contents. Working solutions are commonly divided into single-use aliquots and frozen to avoid repeated freeze-thaw cycles. Dilute solutions are more prone to adsorption onto plastic surfaces and to loss during filtration, so procedures that minimize transfers and use low-binding labware are preferable.
Identity confirmation uses mass spectrometry, usually electrospray ionisation in positive mode or matrix-assisted laser desorption. The protonated free peptide produces a signal near three hundred and ninety-one daltons, while salt adducts shift that value slightly. Tandem mass spectrometry or amino acid analysis supplies sequence-level confirmation, which a single mass measurement cannot. Peptides containing aspartate can cyclise into succinimide intermediates that hydrolyse to isoaspartate isomers of identical mass. Because those isomers are difficult to separate chromatographically, identity and purity results carry more weight when interpreted together.
Storage practice centres on limiting moisture, oxygen, and repeated temperature cycling. Freeze-dried powder is generally held desiccated at minus twenty degrees Celsius or colder and protected from light. Reconstituted solutions are markedly less stable, and the aspartate-glycine junction is prone to succinimide formation at neutral to mildly alkaline pH. Portioning material into single-use aliquots reduces degradation compared with repeated freeze-thaw cycles. Stability data specific to this tetrapeptide remain scarce, so most handling guidance is extrapolated from general peptide chemistry rather than measured directly.
| Property | Value | Notes |
|---|---|---|
| Appearance | White to off-white powder | Lyophilized solid |
| Solubility | Freely soluble in water | Also dissolves in polar organic solvents |
| Typical storage temperature | −20 °C or below | Sealed, desiccated, protected from light |
| Primary purity assay | Reversed-phase HPLC | Ultraviolet detection near 214 nm |
| Identity confirmation | Mass spectrometry | Electrospray ionization commonly used |
Verification of a sample usually begins with reversed-phase high-performance liquid chromatography, which resolves the peptide from truncated sequences and other impurities and expresses purity as a percentage of total peak area. Mass spectrometry by electrospray ionisation or matrix-assisted laser desorption supplies an independent check, because the measured mass can be compared against the theoretical value for AEDG. Amino acid analysis or tandem mass spectrometry sequencing can confirm residue order. Each of these methods answers a different question: a purity figure does not establish identity, and an identity match does not establish how much of the material is intact peptide.
The molecule is a short, linear, hydrophilic peptide that dissolves readily in water or aqueous buffer. Its principal chemical liabilities are hydrolytic rather than oxidative, since it contains no cysteine, methionine, or tryptophan residues. The aspartate–glycine step is a recognised site for aspartimide formation under mildly acidic or basic conditions, generating isoaspartate and succinimide-related products over time. Desiccated lyophilised powder held at −20 °C is comparatively stable, whereas dilute solutions degrade faster and are best frozen as single-use aliquots rather than thawed repeatedly.
No pharmacopoeial monograph exists for this peptide, so quality rests on the supplier's internal specifications and on whatever independent testing a purchaser arranges. Certificates of analysis differ widely in which tests they report and in the limits applied. The counter-ion introduced during purification, commonly acetate or trifluoroacetate, changes the net peptide content of a given mass of powder, so two samples of equal weight may not contain equal amounts of the active sequence. Third-party laboratories can verify purity, identity, residual solvents, and counter-ion content for a fee, which makes documentation more informative than labelling.
Epitalon emerged from research conducted in Saint Petersburg by Vladimir Khavinson and colleagues, who studied short peptides as potential regulators of aging. The work built on epithalamin, a pineal gland extract reported to influence neuroendocrine function. Epitalon was designed as a synthetic counterpart with a defined sequence, allowing reproducible experiments that extracts could not support. Early publications described effects on melatonin rhythms and lifespan in animal models. These findings circulated mainly in Russian-language journals during the 1990s, which limited their visibility among English-speaking researchers.
The most widely cited claim is that epitalon activates telomerase and thereby extends telomere length. Supporting evidence comes largely from cultured human cells, where treatment was associated with increased telomerase activity and delayed replicative senescence. Telomerase activation is a biologically consequential effect, since the enzyme is largely silenced in most somatic cells. However, the route by which a short peptide would reach and act on the enzyme's regulatory machinery has not been established. Independent replication in human trials is scarce, so the link between cell-culture observations and whole-body aging remains an open question.
Human data are limited to small studies, often without the randomization, blinding, or control groups expected in contemporary clinical research. Reported outcomes have included changes in melatonin levels, immune markers, and subjective measures, but sample sizes were generally too small to support firm conclusions. Some reviews treat the peptide as promising while noting methodological weaknesses; others question whether the observed effects are specific. The compound is frequently discussed in longevity-focused communities, where enthusiasm often outpaces the published evidence. Separating established findings from speculation is therefore important when reading summaries of this research.
Freeze-dried epitalon is normally kept at minus twenty degrees Celsius in a sealed, desiccated container, protected from light. Short excursions at ambient temperature during shipping are generally tolerated, but repeated warming and cooling cycles encourage moisture uptake, which shortens shelf life. Once dissolved, the peptide is far less stable than the solid: aqueous solutions are subject to hydrolysis and to deamidation at the aspartate and glutamate residues. Working solutions are therefore held refrigerated and used within days, and repeated freezing and thawing of the same vial is best avoided.
Identity and purity are checked by reversed-phase high-performance liquid chromatography, usually with ultraviolet detection near 214 nanometres, where the peptide bond absorbs. Mass spectrometry confirms the expected mass and reveals whether truncation products or adducts are present. Acid hydrolysis followed by amino acid analysis gives the residue ratio, which should approximate one alanine, one glutamate, one aspartate and one glycine. Counter-ions such as acetate or trifluoroacetate remain in the dried product and lower net peptide content, so a stated purity figure on a label does not by itself describe how much peptide a vial holds.
While European ETSI standards have supported WMAS for several years, the U.S. Federal Communications Commission (FCC) officially adopted rules in February 2024 to allow WMAS operation in the United States. This regulatory change led to the introduction of wideband digital platforms such as Sennheiser’s Spectera and Shure’s Axient Digital PSM (ADPSM), which allow for bidirectional audio and increased spectral efficiency at large-scale events.
promoter A sequence or region of DNA, usually 100–1,000 base pairs long, which regulates the expression of one or more associated genes by containing binding sites for transcription factors which recruit RNA polymerase to the sequence and initiate transcription. Promoters are typically located immediately upstream of the genes they regulate, near to and often including the transcription start site.
=== 2009–2013: Time Machine Tour and Clockwork Angels === On February 16, 2009, Lifeson remarked that the band might begin working on a new album in the fall of 2009, with Nick Raskulinecz again producing. In November 2009, Lee, Lifeson and Peart were awarded the International Achievement Award at the annual SOCAN Awards in Toronto. On March 19, 2010, the CBC posted a video interview with Lee and Lifeson in which they discussed Rush's induction into the Canadian Songwriters Hall of Fame on March 28, 2010, at the Toronto Centre for the Arts' George Weston Recital Hall. The band was recognized for the songs "Limelight", "Closer to the Heart", "The Spirit of Radio", "Tom Sawyer" and "Subdivisions". In addition to discussing their induction, Lee and Lifeson touched on future material, with Lee saying, "Just about a month and a half ago we had no songs. And now we've been writing, and now we've got about 6 songs that we just love..." On March 26, 2010, in an interview with The Globe and Mail, Lifeson remarked that there was even the potential for two supporting tours. Soon afterwards, Peart confirmed that Raskulinecz had returned as co-producer. In April 2010, Rush recorded "Caravan" and "BU2B", two new songs to be featured on the band's then-upcoming studio album Clockwork Angels, at Blackbird Studios in Nashville with Raskulinecz. "Caravan" and "BU2B" were released together on June 1, 2010, and made available for digital download.
== Related methods == Alternative specific enrichment methods include MSIA (“mass spectrometric immunoassay”,) in which antibodies are used to enrich target proteins, which are analyzed intact by MS; and hybrid methods in which antibodies are used to enrich target proteins, which are then digested prior to peptide detection by MS.
Sources: en.wikipedia.org
By convention, the products form the numerator. However, the law of mass action is valid only for concerted one-step reactions that proceed through a single transition state and is not valid in general because rate equations do not, in general, follow the stoichiometry of the reaction as Guldberg and Waage had proposed (see, for example, nucleophilic aliphatic substitution by SN1 or reaction of hydrogen and bromine to form hydrogen bromide). Equality of forward and backward reaction rates, however, is a necessary condition for chemical equilibrium, though it is not sufficient to explain why equilibrium occurs. Despite the limitations of this derivation, the equilibrium constant for a reaction is indeed a constant, independent of the activities of the various species involved, though it does depend on temperature as observed by the van 't Hoff equation. Adding a catalyst will affect both the forward reaction and the reverse reaction in the same way and will not have an effect on the equilibrium constant. The catalyst will speed up both reactions thereby increasing the speed at which equilibrium is reached. Although the macroscopic equilibrium concentrations are constant in time, reactions do occur at the molecular level. For example, in the case of acetic acid dissolved in water and forming acetate and hydronium ions,
18 April to 31 December Operation Dan Thang 69 was conducted by the ARVN 22nd Division in Bình Định Province. The operation resulted in 507 PAVN/VC killed. Operation Dan Tien 33D was conducted by the ARVN 23rd Division in Quang Duc Province. The operation resulted in 746 PAVN/VC killed.
== Prizes and honours == 1997, 1999 Merit scholarship to study Medical Laboratory Technology at Institute of Medicine, Tribhuvan University 2005 Gallwas membership Grant, AACC 2005 and 2007 International travel grant, AACC 2006 Young Achievers Award 2007 International Travel Grant, Asian & Pacific Federation of Clinical Biochemistry (APFCB) 2008 and 2010 KNU Honors Scholarship for Graduation Study (MS and PHD) 2012 Featured member of AACC, interview published at AACC website 2013 KNU Best Publication Award 2014 KNU Cell-Matrix Research Institute Winter Seminar Award
Sources: en.wikipedia.org
== Chemistry == Bulevirtide is a 47-amino acid long lipopeptide with the following sequence: CH3(CH2)12CO-Gly-Thr-Asn-Leu-Ser-Val-Pro-Asn-Pro-Leu-Gly-Phe-Phe-Pro-Asp-His-Gln-Leu-Asp-Pro-Ala-Phe-Gly-Ala-Asn-Ser-Asn-Asn-Pro-Asp-Trp-Asp-Phe-Asn-Pro-Asn-Lys-Asp-His-Trp-Pro-Glu-Ala-Asn-Lys-Val-Gly-NH2 (C13H27CO-GTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANKVG-NH2)
== External links == Goudarzi, Sara (9 June 2006). "Yogurt Culture Evolves". LiveScience. Archived from the original on August 29, 2008. Retrieved 2013-01-14. Type strain of Lactobacillus delbrueckii subsp. bulgaricus at BacDive - the Bacterial Diversity Metadatabase "Lactobacillus delbrueckii". microbewiki.kenyon.edu – Microbe Wiki. Retrieved 2019-11-14.
Sprigg urged Letsie I to negotiate Masopha's unconditional surrender, until a force of Cape Mounted Riflemen (CMR) could arrive to assist him. Letsie I replied that this was unrealistic, as most of the Basuto, including his sons, had rallied behind Masopha. Letsie and his armed retinue, returned to their village on 19 August after several days of negotiations, fearing that they would be ambushed if they remained outside Thaba Bosiu any longer. In a last ditch effort to prevent an uprising, Sprigg visited Letsie I in person. Letsie I then held another pitso—under Sprigg's new terms the rebel chiefs were to appear in court where they would receive a token fine, pledge to compensate those whose property they had seized, and comply with the gun regulations. Masopha remained defiant and held an assembly of his own, where he and Lerotholi began to prepare for war. Masopha believed that the Cape's troops had proved themselves to be incompetent during the suppression of Moorosi's revolt. He was further encouraged by rumors that the British would refuse to reinforce the Cape, and by the British defeat at the Battle of Isandlwana a year prior.
Sources: en.wikipedia.org
The powder is normally kept at −20 °C or below in a sealed, moisture-protected container. Letting the vial reach room temperature before opening helps prevent condensation on the contents.
Reversed-phase HPLC with ultraviolet detection is the usual approach, often paired with mass spectrometry. Together the two methods address both chromatographic purity and molecular identity.
Differences arise from the analytical method, the detection wavelength, and whether the number refers to the peptide or to total powder mass. Counterion and water content can lower the actual peptide fraction considerably.
Reversed-phase high-performance liquid chromatography with ultraviolet detection at 214 nanometres is the usual approach. Peak area percentage provides a purity figure relative to other components in the sample. Mass spectrometry is then applied to confirm identity.